PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bostr.1040s0017.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Boechereae; Boechera
Family HD-ZIP
Protein Properties Length: 720aa    MW: 81468.5 Da    PI: 7.1263
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bostr.1040s0017.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox56.54.7e-182580156
                         TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
             Homeobox  1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                         +++ + ++++q+++Le++F+++++p+  +r++L ++l+L+ +q+k+WFqN+R++ k
  Bostr.1040s0017.1.p 25 KKNHQHHSNHQTRRLEAYFNECPHPDDLQRRQLGEELNLKPKQIKFWFQNKRTQAK 80
                         57778899********************************************9987 PP

2START109.26.5e-352424633206
                          HHHHHHHHHHHHHHC-TT-EEEE.......EXCCTTEEEEEEESSS...SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....EE CS
                START   3 aeeaaqelvkkalaeepgWvkss.......esengdevlqkfeeskv..dsgealrasgvvdmvlallveellddkeqWdetla....ka 79 
                          a +a +e++++++ ee +W kss       +  n+++  +k++  k+   + e +++++vv m++ +lve +ld+  +W + ++    +a
  Bostr.1040s0017.1.p 242 AAKAVAEVMSLIQMEESMWIKSStdgrvviDPGNYEKIFTKISHLKStsARPESSKEVVVVQMDARNLVEMFLDTE-KWARLFPtivnEA 330
                          678999**********************99888888888888776667788999**********************.99999999999** PP

                          EEEEEECTT.......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCE CS
                START  80 etlevissg.......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksngh 161
                          +t+ v++s        + + + ++      plvp R+f ++R+++q++++ w+i dvS   +++         ++++pSg l++ ++ g+
  Bostr.1040s0017.1.p 331 KTIHVLDSVdhrrqifSRVLYEQMHILS--PLVPpREFIILRSCQQMEEDLWLISDVSCHLPNFDFD-FTAPICTKRPSGVLVQALPHGR 417
                          *******999999977666666666655..**********************************995.5555589*************** PP

                          EEEEEEE-EE--SSXX.HHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
                START 162 skvtwvehvdlkgrlp.hwllrslvksglaegaktwvatlqrqcek 206
                          skvtw+ehv++++++  h l+r l+ sg   ga++w+ tl+r ce+
  Bostr.1040s0017.1.p 418 SKVTWIEHVEVNDKVRpHRLYRDLLYSGFGYGARRWTVTLERMCER 463
                          **************955***************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.04E-16982IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.2E-171076IPR009057Homeodomain-like
PROSITE profilePS5007116.0822282IPR001356Homeobox domain
SMARTSM003892.1E-172486IPR001356Homeobox domain
CDDcd000865.79E-162583No hitNo description
PfamPF000461.7E-152580IPR001356Homeobox domain
PROSITE profilePS5084843.324231466IPR002913START domain
SuperFamilySSF559616.79E-28234464No hitNo description
CDDcd088751.67E-90235462No hitNo description
SMARTSM002342.5E-17240463IPR002913START domain
PfamPF018527.9E-29242463IPR002913START domain
Gene3DG3DSA:3.30.530.205.0E-7244428IPR023393START-like domain
SuperFamilySSF559617.0E-10486694No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0008289Molecular Functionlipid binding
Sequence ? help Back to Top
Protein Sequence    Length: 720 aa     Download sequence    Send to blast
MDSSRDDSSN DERGTSMDTN DNQDKKNHQH HSNHQTRRLE AYFNECPHPD DLQRRQLGEE  60
LNLKPKQIKF WFQNKRTQAK IQNEKAENAE LRIENRKIKL ENEAMEEALK TVVCPPCGGR  120
HPGREEQLRY LQKLRSENTF LKREHEKISS YLTQHRGHSI PPRVDALPYL YGPSTYGSTS  180
NNLPASYGTS SNHLSEQSSL LRGPYTRENI KVTPPPKPQK PLLLQHFQPL SQPEKMVMFE  240
TAAKAVAEVM SLIQMEESMW IKSSTDGRVV IDPGNYEKIF TKISHLKSTS ARPESSKEVV  300
VVQMDARNLV EMFLDTEKWA RLFPTIVNEA KTIHVLDSVD HRRQIFSRVL YEQMHILSPL  360
VPPREFIILR SCQQMEEDLW LISDVSCHLP NFDFDFTAPI CTKRPSGVLV QALPHGRSKV  420
TWIEHVEVND KVRPHRLYRD LLYSGFGYGA RRWTVTLERM CERLSLYSMS DFPPTDYAGV  480
VKTIEGRRSV MNLGERMLKN FAWIMKMSDK LDFSQQSVTN NSGVRISVRT NTEAGQPTGL  540
IVCASSSLYL PLPPLQVYDF LRNLEVRHQW DVLCHGNPAT EAARFVTGTD QKNNVTFLQP  600
SSGGDNSELM ILQDGFIDAL GGMLVYAPVD LNTAHSAISG QVDPSTIPIL PSGFIISHDS  660
RPSAGELDGG RMTLLTVAFQ ILVSGPSYST DLNLEDSATT VNTLISSTVQ RVKAMLNCE*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0026841e-115CP002684.1 Arabidopsis thaliana chromosome 1 sequence.
GenBankF21H21e-115AC007894.2 Arabidopsis thaliana chromosome 1 BAC F21H2 sequence, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010478910.10.0PREDICTED: homeobox-leucine zipper protein HDG10-like
SwissprotQ9S9Z00.0HDG10_ARATH; Homeobox-leucine zipper protein HDG10
TrEMBLR0H7P30.0R0H7P3_9BRAS; Uncharacterized protein
STRINGAT1G34650.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM84681531
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G34650.10.0homeodomain GLABROUS 10